Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cathelicidin antimicrobial peptide(CAMP)

Recombinant Human Cathelicidin antimicrobial peptide(CAMP)

SKU:CSB-EP004476HUb3

Regular price £593.00 GBP
Regular price Sale price £593.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P49913

Gene Names: CAMP

Organism: Homo sapiens (Human)

AA Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Expression Region: 132-170aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 24.7 kDa

Alternative Name(s): 18KDA cationic antimicrobial protein

Relevance: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Reference: "FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis." Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. Proc. Natl. Acad. Sci. U.S.A. 92:195-199(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details