Recombinant Human Calcium-dependent phospholipase A2(PLA2G5)

SKU: CSB-YP018103HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cardiovascular

Uniprot ID: P39877

Gene Names: PLA2G5

Organism: Homo sapiens (Human)

AA Sequence: GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Expression Region: 21-138aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.6 kDa

Alternative Name(s): Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Reference: "Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina."Sergouniotis P.I., Davidson A.E., Mackay D.S., Lenassi E., Li Z., Robson A.G., Yang X., Kam J.H., Isaacs T.W., Holder G.E., Jeffery G., Beck J.A., Moore A.T., Plagnol V., Webster A.R.Am. J. Hum. Genet. 89:782-791(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.