Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Calcitonin gene-related peptide 2(CALCB)

Recombinant Human Calcitonin gene-related peptide 2(CALCB)

SKU:CSB-EP004435HU

Regular price £594.00 GBP
Regular price Sale price £594.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P10092

Gene Names: CALCB

Organism: Homo sapiens (Human)

AA Sequence: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA

Expression Region: 1-127aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.7 kDa

Alternative Name(s): Beta-type CGRP

Relevance: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Reference: "Structure and expression of the human calcitonin/CGRP genes." Steenbergh P.H., Hoeppener J.W.M., Zandberg J., Visser A., Lips C.J.M., Jansz H.S. FEBS Lett. 209:97-103(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details