Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial

Recombinant Human C-type lectin domain family 4 member C (CLEC4C) ,partial

CSB-MP855470HU
Regular price
£350.00 GBP
Sale price
£350.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: CLEC4C

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q8WTT0

AA Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Tag info: N-terminal 6xHis-tagged

Expression Region: 45-213aa

Protein length: Extracellular Domain

MW: 24 kDa

Alternative Name(s): Blood dendritic cell antigen 2 Short name: BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen: CD303

Relevance: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.

Reference: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells."Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.Eur. J. Immunol. 31:2733-2740(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share