Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Beta-1,4-galactosyltransferase 1(B4GALT1)

Recombinant Human Beta-1,4-galactosyltransferase 1(B4GALT1)

SKU:CSB-CF002513HU

Regular price £1,463.00 GBP
Regular price Sale price £1,463.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P15291

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

Protein Names:Recommended name: Beta-1,4-galactosyltransferase 1 Short name= Beta-1,4-GalTase 1 Short name= Beta4Gal-T1 Short name= b4Gal-T1 EC= 2.4.1.-Alternative name(s): UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1 UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1Cleaved into the following chain: 1. Processed beta-1,4-galactosyltransferase 1 2. Including the following 4 domains: 3. Lactose synthase A protein EC= 4. 2.4.1.22 5. N-acetyllactosamine synthase EC= 6. 2.4.1.90Alternative name(s): Nal synthase Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase EC= 2.4.1.38 Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase EC= 2.4.1.-

Gene Names:Name:B4GALT1Synonyms:GGTB2

Expression Region:1-398

Sequence Info:full length protein

View full details