Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Bcl-2 homologous antagonist-killer(BAK1)

Recombinant Human Bcl-2 homologous antagonist-killer(BAK1)

SKU:CSB-CF624111HU

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q16611

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Protein Names:Recommended name: Bcl-2 homologous antagonist/killer Alternative name(s): Apoptosis regulator BAK Bcl-2-like protein 7 Short name= Bcl2-L-7

Gene Names:Name:BAK1 Synonyms:BAK, BCL2L7, CDN1

Expression Region:1-211

Sequence Info:full length protein

View full details