Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Aspartoacylase(ASPA)

Recombinant Human Aspartoacylase(ASPA)

SKU:CSB-BP002223HU

Regular price £481.00 GBP
Regular price Sale price £481.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Signal Transduction

Uniprot ID: P45381

Gene Names: ASPA

Organism: Homo sapiens (Human)

AA Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

Expression Region: 1-313aa

Sequence Info: Full Length

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 39.7 kDa

Alternative Name(s): Aminoacylase-2 Short name:ACY-2 ACY2, ASP

Relevance: Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids.

Reference: "Examination of the mechanism of human brain aspartoacylase through the binding of an intermediate analogue." Le Coq J., Pavlovsky A., Malik R., Sanishvili R., Xu C., Viola R.E. Biochemistry 47:3484-3492(2008)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details