Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Apolipoprotein C-II(APOC2)

Recombinant Human Apolipoprotein C-II(APOC2)

SKU:CSB-EP001932HU

Regular price £531.00 GBP
Regular price Sale price £531.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: P02655

Gene Names: APOC2

Organism: Homo sapiens (Human)

AA Sequence: TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Expression Region: 23-101aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.9 kDa

Alternative Name(s): Apolipoprotein C2

Relevance: Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridic individuals, predominantly found in the VLDL and LDL.

Reference: The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.Fojo S.S., Law S.W., Brewer H.B. Jr.FEBS Lett. 213:221-226(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details