Recombinant Human Annexin A8-like protein 2(ANXA8L2)

Recombinant Human Annexin A8-like protein 2(ANXA8L2)

CSB-EP726113HU
Regular price
£422.00 GBP
Sale price
£422.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: Q5VT79

Gene Names: ANXA8L2

Organism: Homo sapiens (Human)

AA Sequence: MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

Expression Region: 1-276aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 57.7 kDa

Alternative Name(s):

Relevance:

Reference: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." Karanjawala Z.E., Illei P.B., Ashfaq R., Infante J.R., Murphy K., Pandey A., Schulick R., Winter J., Sharma R., Maitra A., Goggins M., Hruban R.H. Am. J. Surg. Pathol. 32:188-196(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share