
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: P60006
Gene Names: ANAPC15
Organism: Homo sapiens (Human)
AA Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
Expression Region: 1-121aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 41.3 kDa
Alternative Name(s):
Relevance: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assbly checkpoint. Also required for degradation of CDC20.
Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Anaphase-promoting complex subunit 5(ANAPC5),partial
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Anaphase-promoting complex subunit 10(ANAPC10)
- Regular price
- £423.00 GBP
- Sale price
- £423.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
ANAPC5 Antibody - Cat. #: CSB-PA05104A0Rb
- Regular price
- £258.00 GBP
- Sale price
- £258.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
ANAPC5 Antibody - Cat. #: CSB-PA892130ESR1HU
- Regular price
- £258.00 GBP
- Sale price
- £258.00 GBP
- Regular price
-
- Unit price
- per
Sold out