Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Anaphase-promoting complex subunit 10(ANAPC10)

Recombinant Human Anaphase-promoting complex subunit 10(ANAPC10)

SKU:CSB-EP892350HU

Regular price £580.00 GBP
Regular price Sale price £580.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q9UM13

Gene Names: ANAPC10

Organism: Homo sapiens (Human)

AA Sequence: TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Expression Region: 1-185aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 48.1 kDa

Alternative Name(s): Cyclosome subunit 10

Relevance: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.

Reference: "Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex." Grossberger R., Gieffers C., Zachariae W., Podtelejnikov A.V., Schleiffer A., Nasmyth K., Mann M., Peters J.-M. J. Biol. Chem. 274:14500-14507(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details