Recombinant Human adenovirus C serotype 2  Early E3B 14.5 kDa protein

Recombinant Human adenovirus C serotype 2 Early E3B 14.5 kDa protein

CSB-CF365889HIK
Regular price
£863.00 GBP
Sale price
£863.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)

Uniprot NO.:P03250

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIYPYLDI GWNAIDAMNHPTFPVPAVIPLQQVIAPINQPRPPSPTPTEISYFNLTGGDD

Protein Names:Recommended name: Early E3B 14.5 kDa protein

Gene Names:

Expression Region:20-130

Sequence Info:full length protein

Your list is ready to share