Gene Bio Systems
Recombinant Human adenovirus B serotype 3 Early E3 9.0 kDa glycoprotein
Recombinant Human adenovirus B serotype 3 Early E3 9.0 kDa glycoprotein
SKU:CSB-CF319988HIG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human adenovirus B serotype 3 (HAdV-3) (Human adenovirus 3)
Uniprot NO.:P11317
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MILFQSNTTTSYAYTNIQPKYAMQLEITILIVIGILILSVILYFIFCRQIPNVHRNSKRR PIYSPMISRPHMALNEI
Protein Names:Recommended name: Early E3 9.0 kDa glycoprotein
Gene Names:
Expression Region:1-77
Sequence Info:full length protein
