Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Adenine phosphoribosyltransferase(APRT)

Recombinant Human Adenine phosphoribosyltransferase(APRT)

SKU:CSB-EP001954HU

Regular price £581.00 GBP
Regular price Sale price £581.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P07741

Gene Names: APRT

Organism: Homo sapiens (Human)

AA Sequence: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Expression Region: 1-180aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 46.5 kDa

Alternative Name(s):

Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Reference: "Comparative anatomy of the human APRT gene and enzyme: nucleotide sequence divergence and conservation of a nonrandom CpG dinucleotide arrangement." Broderick T.P., Schaff D.A., Bertino A.M., Dush M.K., Tischfield J.A., Stambrook P.J. Proc. Natl. Acad. Sci. U.S.A. 84:3349-3353(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details