Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Acrosomal protein SP-10(ACRV1)

Recombinant Human Acrosomal protein SP-10(ACRV1)

SKU:CSB-EP001186HU

Regular price £582.00 GBP
Regular price Sale price £582.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P26436

Gene Names: ACRV1

Organism: Homo sapiens (Human)

AA Sequence: QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

Expression Region: 22-265aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.8 kDa

Alternative Name(s): Acrosomal vesicle protein 1

Relevance:

Reference: Characterization of alternatively spliced human SP-10 mRNAs.Freemerman A.J., Flickinger C.J., Herr J.C.Mol. Reprod. Dev. 41:100-108(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details