Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial

SKU:CSB-EP001308HU

Regular price £567.00 GBP
Regular price Sale price £567.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cancer

Uniprot ID:O95450

Gene Names:ADAMTS2

Organism:Homo sapiens (Human)

AA Sequence:RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC

Expression Region:254-492aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:32.2 kDa

Alternative Name(s):Procollagen I N-proteinase (PC I-NP) (Procollagen I/II amino propeptide-processing enzyme) (Procollagen N-endopeptidase) (pNPI) (ADAM-TS 2) (ADAM-TS2) (ADAMTS-2) (PCINP) (PCPNI)

Relevance:Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.

Reference:"Domains and maturation processes that regulate the activity of ADAMTS-2, a metalloproteinase cleaving the aminopropeptide of fibrillar procollagens types I-III and V." Colige A., Ruggiero F., Vandenberghe I., Dubail J., Kesteloot F., Van Beeumen J., Beschin A., Brys L., Lapiere C.M., Nusgens B. J. Biol. Chem. 280:34397-34408(2005)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.

Involvement in disease:Ehlers-Danlos syndrome 7C (EDS7C)

Subcellular Location:Secreted, extracellular space, extracellular matrix

Protein Families:

Tissue Specificity:Expressed at high level in skin, bone, tendon and aorta and at low levels in thymus and brain.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:218

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=23871

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:9509

STRING Database Link:https://string-db.org/network/9606.ENSP00000251582

OMIM Database Link:https://www.omim.org/entry/225410225410225410

Lead Time Guidance:13-23 business days

View full details