Gene Bio Systems
Recombinant Horse UPF0767 protein C1orf212 homolog
Recombinant Horse UPF0767 protein C1orf212 homolog
SKU:CSB-CF520542HO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equus caballus (Horse)
Uniprot NO.:F6USH3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKEPQPVEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Protein Names:Recommended name: UPF0767 protein C1orf212 homolog
Gene Names:
Expression Region:1-92
Sequence Info:full length protein
