Skip to product information
1 of 1

GeneBio Systems

Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)

Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase (npp)

SKU:Q687E1

Regular price £424.00 GBP
Regular price Sale price £424.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q687E1

Gene Names: npp

Alternative Name(s):

Abbreviation: Recombinant Hordeum vulgare Nucleotide pyrophosphatase/phosphodiesterase protein

Organism: Hordeum vulgare (Barley)

Source: E.coli

Expression Region: 1-368aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: AAVRASPDLLGSRGEDTASDGSVVWAKPYTFRAPPTPGQNSLQRIIVFGDMGKAERDGSNEFANYQPGSLNTTDRLIEDLDNYDIVFHIGDMPYANGYLSQWDQFTAQVAPISAKKPYMVASGNHERDWPNTGGFFDVKDSGGECGVPAETMYYYPAENRANFWYKVDYGMFRFCVGDSEHDWREGTPQYKFIEECLSTVDRKHQPWLIFTAHRVLGYSSNSWYADQGSFEEPEGRESLQKLWQRYRVDIAYFGHVHNYERTCPLYQSQCVNADKTHYSGTMNGTIFVVAGGGGSHLSSYTTAIPKWSIFRDHDYGFTKLTAFNHSSLLFEYMKSSDGKVYDSFTIHRDYRDVLSCVHDSCFPTTLAS

MW: 49.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Hydrolyzes pyrophosphate, phosphodiester and phosphosulfate linkages of nucleotide-sugars, sulfonucleotides and nucleoside di and triphosphates. Highest activity observed with the substrates ADP-glucose and adenosine 5'-phosphosulfate.

Reference: "Cloning, expression and characterization of a glycosylated nucleotide pyrophosphatase/phosphodiesterase occurring in chloroplasts that belongs to a widely distributed group of plant nucleotide hydrolases." Nanjo Y., Rodriguez-Lopez M., Munoz F.J., Kurokawa S., Baroja-Fernandez E., Mitsui T., Pozueta-Romero J. Submitted (AUG-2003)

Function:

View full details