Gene Bio Systems
Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV90, chloroplastic
Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV90, chloroplastic
SKU:CSB-CF318611HWQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hordeum vulgare (Barley)
Uniprot NO.:P14897
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VRAQTEGPSAPPPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLL SQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVAL AATEIITGAPFINV
Protein Names:Recommended name: Low molecular mass early light-inducible protein HV90, chloroplastic Short name= ELIP
Gene Names:
Expression Region:39-172
Sequence Info:full length protein
