Gene Bio Systems
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic(LHC Ib-21)
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic(LHC Ib-21)
SKU:CSB-CF874392HWQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hordeum vulgare (Barley)
Uniprot NO.:Q9SDM1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVP EALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEK KKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATH LADPWHNNIGDIVIPRNIYGP
Protein Names:Recommended name: Chlorophyll a-b binding protein 1B-21, chloroplastic Alternative name(s): LHCI type I CAB-1B-21 LHCI-730 chlorophyll a/b binding protein Light-harvesting complex I 21 kDa protein
Gene Names:Name:LHC Ib-21 Synonyms:LHCA1
Expression Region:45-245
Sequence Info:full length protein
