Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heme transporter hrg-4(hrg-4)

Recombinant Heme transporter hrg-4(hrg-4)

SKU:CSB-CF638545CXY

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q20106

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHAFLVIKYYWHIFFVEFSKCTSSTRGSAKKEHVNYRMTAENRGFCQLICHINVRIGWT IFGIVFGISAILTYAIKFHNWSATATTAIATLFACETLYLYWALKKNTIVNWKSSTFQLM IWPNVFIGLLGLLGCLVCYIIAGITHQGAGSIQAMYGENLWFTGSWSLVITKWTWQNAFF ARKYLNKIGTASEDGDIDDDDVEVIKS

Protein Names:Recommended name: Heme transporter hrg-4 Alternative name(s): Heme-responsive gene 4 protein Short name= CeHRG-4

Gene Names:Name:hrg-4 ORF Names:F36H1.5

Expression Region:1-207

Sequence Info:full length protein

View full details