Gene Bio Systems
Recombinant Helicobacter pylor DNA protection during starvation protein(dps)
Recombinant Helicobacter pylor DNA protection during starvation protein(dps)
SKU:CSB-EP337381HUV
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: dps
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Delivery time: 3-7 business days
Uniprot ID: P43313
AA Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-144aa
Protein length: Full Length
MW: 32.9 kDa
Alternative Name(s): Bacterioferritin HP-NAP Neutrophil-activating protein A Short name:NAP A
Relevance: Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.
Reference: "Identification of four new prokaryotic bacterioferritins, from Helicobacter pylori, Anabaena variabilis, Bacillus subtilis and Treponema pallidum, by analysis of gene sequences."Evans D.J. Jr., Evans D.G., Lampert H.C., Nakano H.Gene 153:123-127(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
