Gene Bio Systems
Recombinant Halorubrum lacusprofundi UPF0290 protein Hlac_0350 (Hlac_0350)
Recombinant Halorubrum lacusprofundi UPF0290 protein Hlac_0350 (Hlac_0350)
SKU:CSB-CF498606HUB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Uniprot NO.:B9LSA9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIGSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRDWRGARLLGDGKTWRGTAVGTLTG VVLALALNRIAEPASAALGVDLPTFALPAAFALAFGAMCGDIGASFLKRRSGRERGAAFP GLDQLDFVVVALAAVFVVDTDWALAVFTPSVLVVVLVMTPILHVVTNVGAYALGLKNEPW
Protein Names:Recommended name: UPF0290 protein Hlac_0350
Gene Names:Ordered Locus Names:Hlac_0350
Expression Region:1-180
Sequence Info:full length protein
