Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloarcula marismortui Protein CrcB homolog 2(crcB2)

Recombinant Haloarcula marismortui Protein CrcB homolog 2(crcB2)

SKU:CSB-CF722757HTJ

Regular price £1,222.00 GBP
Regular price Sale price £1,222.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Uniprot NO.:Q5V069

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVALESAHLVGAGGALGALCRHYLAGAIQRETFPLGTLTVNAFGSFALGLLTFAGVTGDA ALLVGVGACGSFTTFSSFSVETVRLWENGYVALAALNAVGNLACALVGIGLAWGIVRIV

Protein Names:Recommended name: Protein CrcB homolog 2

Gene Names:Name:crcB2 Ordered Locus Names:rrnAC2253

Expression Region:1-119

Sequence Info:full length protein

View full details