Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus somnus UPF0756 membrane protein HS_0993(HS_0993)

Recombinant Haemophilus somnus UPF0756 membrane protein HS_0993(HS_0993)

SKU:CSB-CF611112HAAD

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt))

Uniprot NO.:Q0I372

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLQFNSIALLLVSLILLGVLGNNSSITISATILLLMQQTFLAKYIPFTEKYGVNIGIII LTIGVLSPIVSGKVQLPNWTALIHWKMFLAMAVGVLVAWFGGRGVNLMGTQPSLLTGLLV GTILGVAFLGGVPVGPLIAAGILSLFIGKTG

Protein Names:Recommended name: UPF0756 membrane protein HS_0993

Gene Names:Ordered Locus Names:HS_0993

Expression Region:1-151

Sequence Info:full length protein

View full details