Gene Bio Systems
Recombinant Haemophilus influenzae UPF0756 membrane protein NTHI1233(NTHI1233)
Recombinant Haemophilus influenzae UPF0756 membrane protein NTHI1233(NTHI1233)
SKU:CSB-CF700069HAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain 86-028NP)
Uniprot NO.:Q4QLL5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFLSSHIPLLEKYGVKIGIII LTIGVLSPLVSGKIQLPDLSGFLSWKMALSIAVGVLVAWLAGKGVPLMGEQPILVTGLLI GTIIGVAFLGGIPVGPLIAAGILALLLGKI
Protein Names:Recommended name: UPF0756 membrane protein NTHI1233
Gene Names:Ordered Locus Names:NTHI1233
Expression Region:1-150
Sequence Info:full length protein
