Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Uncharacterized protein HI_0633 (HI_0633)

Recombinant Haemophilus influenzae Uncharacterized protein HI_0633 (HI_0633)

SKU:CSB-CF332053HTA

Regular price £1,205.00 GBP
Regular price Sale price £1,205.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P44026

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLWDLSGGMVDQRFLVILCMVAFLAGCTQSPVTASVIVMEMTGAQPVLIWLLISSIIASI ISHQFSPKPFYHFAAGCFLQQMQARQAEELRSKTEQEK

Protein Names:Recommended name: Uncharacterized protein HI_0633

Gene Names:Ordered Locus Names:HI_0633

Expression Region:1-98

Sequence Info:full length protein

View full details