Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Protein psiE homolog(psiE)

Recombinant Haemophilus influenzae Protein psiE homolog(psiE)

SKU:CSB-CF689892HAAA

Regular price £1,219.00 GBP
Regular price Sale price £1,219.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain 86-028NP)

Uniprot NO.:Q4QMJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEESLELEKLPRIITDVLKIVLCTALIALAIVLIIALVKITYTLSMMVLNTSSVVPYDVA EQAVMFFLYFGFIGLIVQYFKSGYHFPLRYFIYAGITAMLRLIIVNHESSVDTILFAGAI LIMVIALCLVLYSNKLKNI

Protein Names:Recommended name: Protein psiE homolog

Gene Names:Name:psiE Ordered Locus Names:NTHI0856

Expression Region:1-139

Sequence Info:full length protein

View full details