Skip to product information
1 of 1

GeneBio Systems

Recombinant Haemophilus influenzae 50S ribosomal protein L4 (rplD)

Recombinant Haemophilus influenzae 50S ribosomal protein L4 (rplD)

SKU:A5UDU6

Regular price £584.00 GBP
Regular price Sale price £584.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A5UDU6

Gene Names: rplD

Alternative Name(s):

Abbreviation: Recombinant Haemophilus influenzae rplD protein

Organism: Haemophilus influenzae (strain PittEE)

Source: E.coli

Expression Region: 1-200aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGTRAQKTRAEVSGSGKKPWRQKGTGRARAGDIKSPIWRSGGTTFAAKPQDHSQKVNKKMYRGAIKSILSELVRQDRLVVVEKFELDAPKTKVLVQKLKDLAVEDALIITASLDENLFLAARNLYKVDVRDVQGIDPVSLIAFDKVIVTVDAVKQIEEILA

MW: 27.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: One of the primary rRNA binding proteins, this protein initially binds near the 5'-end of the 23S rRNA. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome. ; Forms part of the polypeptide exit tunnel.

Reference: "Characterization and modeling of the Haemophilus influenzae core and supragenomes based on the complete genomic sequences of Rd and 12 clinical nontypeable strains." Hogg J.S., Hu F.Z., Janto B., Boissy R., Hayes J., Keefe R., Post J.C., Ehrlich G.D. Genome Biol. 8: R103.1-R103.18(2007)

Function:

View full details