Gene Bio Systems
Recombinant Haemophilus ducreyi Fumarate reductase subunit D(frdD)
Recombinant Haemophilus ducreyi Fumarate reductase subunit D(frdD)
SKU:CSB-CF352045HSY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Uniprot NO.:P59844
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKQDPKRSNEPPVWLMFSAGGTISAICFPVLILILGILLPLGLIPMDNIIVFAHTWLGK LVILAVTIFPMWAGMHRVHHGLHDLKIHLPASGWLFYGLSTLYSIVVLFAVIAL
Protein Names:Recommended name: Fumarate reductase subunit D
Gene Names:Name:frdD Ordered Locus Names:HD_0034
Expression Region:1-114
Sequence Info:full length protein
