Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guinea pig Saposin-C(PSAP)

Recombinant Guinea pig Saposin-C(PSAP)

SKU:CSB-YP018836GU

Regular price £875.00 GBP
Regular price Sale price £875.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Metabolism

Uniprot ID: P20097

Gene Names: PSAP

Organism: Cavia porcellus (Guinea pig)

AA Sequence: ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG

Expression Region: 1-81aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 10.9 kDa

Alternative Name(s): Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 ;SAP-2

Relevance: Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.

Reference: The activator protein for glucosylceramide beta-glucosidase from guinea pig liver. Improved isolation method and complete amino acid sequence.Sano A., Radin N.S., Johnson L.L., Tarr G.E.J. Biol. Chem. 263:19597-19601(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details