Recombinant Guanarito virus  Pre-glycoprotein polyprotein GP complex(GPC)

Recombinant Guanarito virus Pre-glycoprotein polyprotein GP complex(GPC)

CSB-CF807311GCAC
Regular price
£940.00 GBP
Sale price
£940.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Guanarito virus (isolate Human/Venezuela/NH-95551/1990) (GTOV)

Uniprot NO.:Q8AYW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AFFSWSLSDPKGNDMPGGYCLERWMLVAGDLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN KNAIEKLNNQTKTAVNMLTHSINSLISDNLLMRNKLKEILKVPYCNYTRFWYINHTKSGE HSLPRCWLVSNGSYLNESDFRNEWILESDHLIAEMLSKEYQDRQGKTPLTLVDLCFWSAI FFTTSLFLHLVGFPTHRHIQGDPCPLPHRLDRNGACRCGRFQKLGKQVTWKRKH

Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2

Gene Names:Name:GPC Synonyms:GP-C

Expression Region:246-479

Sequence Info:full length protein

Your list is ready to share