Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gossypium hirsutum Oleosin 16.4 kDa(MATP7)

Recombinant Gossypium hirsutum Oleosin 16.4 kDa(MATP7)

SKU:CSB-CF328912GHB

Regular price £1,226.00 GBP
Regular price Sale price £1,226.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Uniprot NO.:P29528

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADRDRSYRTFDQVVRGDRTNYQSGPSTTQVLTVLTLLPIGGTLLALAGLTLTGTVIGLCM ATPLFVIFSPVLVPAAIAVFMAVAGFLSSGAFGLTGLSSLSYVFNRFRQATGTEQLDADR AKRGMQDMVGYVGQKTKETGQTIENKAHEGGRT

Protein Names:Recommended name: Oleosin 16.4 kDa

Gene Names:Name:MATP7

Expression Region:2-154

Sequence Info:full length protein

View full details