Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gorilla gorilla gorilla Galactoside 2-alpha-L-fucosyltransferase 2(FUT2)

Recombinant Gorilla gorilla gorilla Galactoside 2-alpha-L-fucosyltransferase 2(FUT2)

SKU:CSB-CF009076GGZ

Regular price £1,417.00 GBP
Regular price Sale price £1,417.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gorilla gorilla gorilla (Lowland gorilla)

Uniprot NO.:O77486

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSQPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSPIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH

Protein Names:Recommended name: Galactoside 2-alpha-L-fucosyltransferase 2 EC= 2.4.1.69 Alternative name(s): Alpha(1,2)FT 2 Fucosyltransferase 2 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2

Gene Names:Name:FUT2

Expression Region:1-343

Sequence Info:full length protein

View full details