Skip to product information
1 of 1

Gene Bio Systems

Recombinant Goat Cytochrome c oxidase subunit 2(MT-CO2)

Recombinant Goat Cytochrome c oxidase subunit 2(MT-CO2)

SKU:CSB-CF654304GO

Regular price £1,319.00 GBP
Regular price Sale price £1,319.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Capra hircus (Goat)

Uniprot NO.:Q37430

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Protein Names:Recommended name: Cytochrome c oxidase subunit 2 Alternative name(s): Cytochrome c oxidase polypeptide II

Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2

Expression Region:1-227

Sequence Info:full length protein

View full details