Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycerol-3-phosphate acyltransferase 1(plsY1)

Recombinant Glycerol-3-phosphate acyltransferase 1(plsY1)

SKU:CSB-CF802407BQE

Regular price £1,257.00 GBP
Regular price Sale price £1,257.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81QF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQKVNDYMINSMQFLYLVASYLFGNILTAYIVTKWRHNVDIRDEGSGNPGARNMGRVYGK GYFVATFLGDAIKGAIVVSIAKYLFEDFTFVMLTLLAVIMGHIYPMLFKGKGGKGISTFI GGLIAFDYLIALTLVAVFIIFYLIFKGFTKPGLITIACLPLCMILYSYSIVTTILSALII VLILYVNHE

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY1 Ordered Locus Names:BA_2467, GBAA_2467, BAS2295

Expression Region:1-189

Sequence Info:full length protein

View full details