Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gluconacetobacter diazotrophicus UPF0060 membrane protein GDI3492-Gdia_2889 (GDI3492, Gdia_2889)

Recombinant Gluconacetobacter diazotrophicus UPF0060 membrane protein GDI3492-Gdia_2889 (GDI3492, Gdia_2889)

SKU:CSB-CF433593GEN

Regular price £1,197.00 GBP
Regular price Sale price £1,197.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

Uniprot NO.:A9H4G8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRMLLGSFAVYAAAALCEIGGCYAWWCWRRAGAGAWVLLPGMASLALFGWLLTLVDSDTA GRTFAAYGGIYIVGAIVWLRLVEGRPVTLRDAAGVAICLAGAAIILSAGRGAER

Protein Names:Recommended name: UPF0060 membrane protein GDI3492/Gdia_2889

Gene Names:Ordered Locus Names:GDI3492, Gdia_2889

Expression Region:1-114

Sequence Info:full length protein

View full details