Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus kaustophilus UPF0059 membrane protein GK3374(GK3374)

Recombinant Geobacillus kaustophilus UPF0059 membrane protein GK3374(GK3374)

SKU:CSB-CF686409GAAA

Regular price £1,255.00 GBP
Regular price Sale price £1,255.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Geobacillus kaustophilus (strain HTA426)

Uniprot NO.:Q5KUH7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGAFIGEIIALSMMALALGMDAFSVALGMGLLRLRLRQMFYIGLTIGLFHILMPLAGMAV GRLLSREFGSVATYAGGALLLWLGGQMIIASFRRDDGSPLFPRGVGLLFFAFSVSLDSFS VGLSLGIFGARTMVTILLFGLFSMVLTWVGLFVGRHFQQWLGSYSEALGGSILLAFGLKL LFL

Protein Names:Recommended name: UPF0059 membrane protein GK3374

Gene Names:Ordered Locus Names:GK3374

Expression Region:1-183

Sequence Info:full length protein

View full details