Gene Bio Systems
Recombinant Frankia sp. UPF0060 membrane protein Francci3_2786(Francci3_2786)
Recombinant Frankia sp. UPF0060 membrane protein Francci3_2786(Francci3_2786)
SKU:CSB-CF644260FAAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Frankia sp. (strain CcI3)
Uniprot NO.:Q2J997
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGVVRSLLLFVVAAVTEIGGAWLVWQGVREHRGPVWVGLGIGFLAAYGFVATLQPDAHFG RILAAYGGVFVAGSLLWGVAVDGFRPDRYDLAGAAICLLGVAVIMYARRV
Protein Names:Recommended name: UPF0060 membrane protein Francci3_2786
Gene Names:Ordered Locus Names:Francci3_2786
Expression Region:1-110
Sequence Info:full length protein
