Gene Bio Systems
Recombinant Francisella tularensis subsp. mediasiatica Lipoprotein signal peptidase(lspA)
Recombinant Francisella tularensis subsp. mediasiatica Lipoprotein signal peptidase(lspA)
SKU:CSB-CF464437FFF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Francisella tularensis subsp. mediasiatica (strain FSC147)
Uniprot NO.:B2SF87
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLLRPKLKYFILAILIIAADLYTKYLANTYLEFAQSLKITSFFNLTLLYNHGAAFSLLS NDQTSWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYV IDFLDFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKKS
Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Gene Names:Name:lspA Ordered Locus Names:FTM_0502
Expression Region:1-161
Sequence Info:full length protein
