Gene Bio Systems
Recombinant Fowlpox virus L5 homolog (FPV132)
Recombinant Fowlpox virus L5 homolog (FPV132)
SKU:CSB-CF325389FEY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fowlpox virus (strain NVSL) (FPV)
Uniprot NO.:P15914
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDRNINFSPVFIEPRFKHEFLLSPQRYFYILVFEVIVALIILNFFFKEEILYTFFPLAKP SKNSINSLLDRTMLKCEEDGSLMISRPSGIYSALSLDGSPVRISDCSLLLSSINGASSST SPYSIFNRR
Protein Names:Recommended name: L5 homolog Alternative name(s): Protein FPV132
Gene Names:Ordered Locus Names:FPV132 ORF Names:FP6
Expression Region:1-129
Sequence Info:full length protein
