Skip to product information
1 of 1

Gene Bio Systems

Recombinant Flagellar biosynthetic protein FliQ(fliQ)

Recombinant Flagellar biosynthetic protein FliQ(fliQ)

SKU:CSB-CF358086SWW

Regular price £1,066.00 GBP
Regular price Sale price £1,066.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:P0A1L6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFI AIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Protein Names:Recommended name: Flagellar biosynthetic protein FliQ

Gene Names:Name:fliQ Synonyms:flaQ Ordered Locus Names:STY2188, t0897

Expression Region:1-89

Sequence Info:full length protein

View full details