GeneBio Systems
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial (Active)
Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial (Active)
SKU:D6S9W1
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Yes
Research Areas: Others
Uniprot ID: D6S9W1
Gene Names: HMPREF0391_11247
Alternative Name(s):
Abbreviation: Recombinant Finegoldia HMPREF0391_11247 protein, partial (Active)
Organism: Finegoldia magna ATCC 53516
Source: Mammalian cell
Expression Region: 106-470aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged
Target Protein Sequence: KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG
MW: 43.3 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.
Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Peptostreptococcus magnus protein L at 2 μg/mL can bind Anti-CTLA4 recombinant antibody(CSB-RA006163MA2HU).The EC50 is 1.601-1.944 ng/mL.
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: Muzny D., Qin X., Buhay C., Dugan-Rocha S., Ding Y., Chen G., Hawes A., Holder M., Jhangiani S. Submitted to EMBL/GenBank/DDBJ databases (MAY-2010)
Function:
