Skip to product information
1 of 1

Gene Bio Systems

Recombinant Exiguobacterium sp. UPF0397 protein EAT1b_2102 (EAT1b_2102)

Recombinant Exiguobacterium sp. UPF0397 protein EAT1b_2102 (EAT1b_2102)

SKU:CSB-CF504665EPU

Regular price £1,252.00 GBP
Regular price Sale price £1,252.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

Uniprot NO.:C4L1J3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSFTTKQIVATGIGAAVFIILSRFAAIPTGVPNTSIETAYAFLAFMAVLFGPITAGLIG LIGHALKDAILYGSPWWSWVIVSGFVGLGIGLIANRIRLEEGGLTTKKIILFNATQAVVQ AIGWIVIAPVLDILIYAEPANKVFVQGAVAATSNILTVGVIGTLLLVTYAKTRSQAGSLK REA

Protein Names:Recommended name: UPF0397 protein EAT1b_2102

Gene Names:Ordered Locus Names:EAT1b_2102

Expression Region:1-183

Sequence Info:full length protein

View full details