Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Putative inner membrane protein yafU(yafU)

Recombinant Escherichia coli Putative inner membrane protein yafU(yafU)

SKU:CSB-CF302862ENV

Regular price £1,085.00 GBP
Regular price Sale price £1,085.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P77354

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSERDLVNFLGDFSMDVAKAVIAGGVATAIGSLASFACVSFGFPVILVGGAILLTGIVC TVVLNEIDAQCHLSEKLKYAIRDGLKRQQELDKWKRENMTPFMYVLNTPPVI

Protein Names:Recommended name: Putative inner membrane protein yafU

Gene Names:Name:yafU Ordered Locus Names:b0218, JW0207

Expression Region:1-112

Sequence Info:full length protein

View full details