Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Putative DNA utilization protein HofO(hofO)

Recombinant Escherichia coli Putative DNA utilization protein HofO(hofO)

SKU:CSB-CF332702ENV

Regular price £1,219.00 GBP
Regular price Sale price £1,219.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P45751

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNMFFDWWFATSPRLRQLCWAFWLLMLVTLIFLSSTHHEERDALIRLRASHHQQWAALYR LVDTAPFSEEKTLPFSPLDFQLSGAQLVSWHPSAQGGELALKTLWEAVPSAFTRLAERNV SVSRFSLSVEGDDLLFTLQLETPHEG

Protein Names:Recommended name: Putative DNA utilization protein HofO

Gene Names:Name:hofO Synonyms:yrfB Ordered Locus Names:b3393, JW3356

Expression Region:1-146

Sequence Info:full length protein

View full details