GeneBio Systems
Recombinant Escherichia coli Putative anti-FlhC (2)FlhD (4) factor YdiV (ydiV)
Recombinant Escherichia coli Putative anti-FlhC (2)FlhD (4) factor YdiV (ydiV)
SKU:P76204
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P76204
Gene Names: ydiV
Alternative Name(s):
Abbreviation: Recombinant E.coli ydiV protein
Organism: Escherichia coli (strain K12)
Source: E.coli
Expression Region: 1-237aa
Protein Length: Full Length
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: MKIFLENLYHSDCYFLPIRDNQQVLVGVELITHFSSEDGTVRIPTSRVIAQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITTLVQR
MW: 29.4 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Upon overexpression acts as a novel anti-FlhC(2)FlhD(4) factor, decreasing its DNA-binding activity, able to negatively regulate expression of flagellar class II operons including FliC.
Reference:
Function:
