Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Probable intracellular septation protein A(yciB)

Recombinant Escherichia coli Probable intracellular septation protein A(yciB)

SKU:CSB-CF485001ENM

Regular price £1,250.00 GBP
Regular price Sale price £1,250.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain 55989 / EAEC)

Uniprot NO.:B7LHK0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Name:yciB Ordered Locus Names:EC55989_1352

Expression Region:1-179

Sequence Info:full length protein

View full details