Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Probable diguanylate cyclase YedQ (yedQ),partial

Recombinant Escherichia coli Probable diguanylate cyclase YedQ (yedQ),partial

SKU:CSB-RP085244Ba

Regular price £796.00 GBP
Regular price Sale price £796.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P76330

Gene Names: yedQ

Organism: Escherichia coli (strain K12)

AA Sequence: RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA

Expression Region: 381-564aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47.5 kDa

Alternative Name(s): Cellulose synthesis regulatory protein

Relevance: Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.

Reference: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S. , Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details