Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O7:K1 UPF0060 membrane protein ynfA(ynfA)

Recombinant Escherichia coli O7:K1 UPF0060 membrane protein ynfA(ynfA)

SKU:CSB-CF484731EON

Regular price £1,202.00 GBP
Regular price Sale price £1,202.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Uniprot NO.:B7NUQ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRA

Protein Names:Recommended name: UPF0060 membrane protein ynfA

Gene Names:Name:ynfA Ordered Locus Names:ECIAI39_1476

Expression Region:1-108

Sequence Info:full length protein

View full details